PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G271600.1
Common NameB456_004G271600, LOC105792811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family DBB
Protein Properties Length: 123aa    MW: 13391.6 Da    PI: 6.4666
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G271600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.83.3e-06446541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+++e   ++  C  ++  lC +C ++ H        H++ p
  Gorai.004G271600.1  4 QCNLCEAAVAKVLCCADEAALCLECDEKVHAAnklvseHQRLP 46
                        7*****************************6678888888776 PP

2zf-B_box25.23.4e-085487235
            zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                        +++kC+ ++e    +fC +++ llC++C +++H 
  Gorai.004G271600.1 54 QMPKCDICQEISGFFFCLQDRALLCRKCDVAIHT 87
                        789*******889*******************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.196147IPR000315B-box-type zinc finger
CDDcd000213.27E-5347No hitNo description
SMARTSM003369.6E-8447IPR000315B-box-type zinc finger
SMARTSM003369.1E-1253100IPR000315B-box-type zinc finger
PfamPF006431.2E-55487IPR000315B-box-type zinc finger
CDDcd000213.82E-55687No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MRIQCNLCEA AVAKVLCCAD EAALCLECDE KVHAANKLVS EHQRLPLFSS SSFQMPKCDI  60
CQEISGFFFC LQDRALLCRK CDVAIHTVNS VVSCHQRFLL TGVEVDVGTK TDTIGASCFN  120
AK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5902585e-95JX590258.1 Gossypium hirsutum clone NBRI_GE25138 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477061.11e-84PREDICTED: B-box zinc finger protein 22-like
SwissprotQ9SYM27e-56BBX22_ARATH; B-box zinc finger protein 22
TrEMBLA0A0D2R5192e-84A0A0D2R519_G
STRINGPOPTR_0011s10670.17e-55(Populus trichocarpa)
STRINGGLYMA13G33987.16e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125022430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.16e-43light-regulated zinc finger protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]